DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nwk and LOC100537850

DIOPT Version :9

Sequence 1:NP_001286994.1 Gene:nwk / 39052 FlyBaseID:FBgn0263456 Length:1075 Species:Drosophila melanogaster
Sequence 2:XP_003200461.2 Gene:LOC100537850 / 100537850 -ID:- Length:175 Species:Danio rerio


Alignment Length:179 Identity:75/179 - (41%)
Similarity:113/179 - (63%) Gaps:5/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPPPRKGNYVKFLKNLHTEQVAKLQLKNQHECDLLEDIRQFTIKRSAVEKSYSESLLKISSQYL 65
            |||||||....:.|||.|.||:.:|.||:|.|||||||:|.::.|::.:|:.|:::|.|::||||
Zfish     1 MQPPPRKVKVTQELKNTHVEQLGRLHLKHQTECDLLEDMRTYSQKKATLERDYAQALQKLASQYL 65

  Fly    66 NKKIPNI-PDIKMEGMEERWNMWSVWRTVLEENEKLARARLAAIEVFQQQIADEAKVLRDYKLAI 129
            .:..|.| ||   :...:..|::.|||..||...::.::||...:.::.:|.|.||.:|.||...
Zfish    66 KRDWPGIKPD---DQRTDYRNVYGVWRAYLEGTVQVTQSRLNVCDNYKNEITDPAKTVRLYKEQQ 127

  Fly   130 AKRSLAGIVNVQKELHLSVGDVDKTKKSYFDEEHCAHDVRDKARDIEEK 178
            .|:.:..:..:|.||..||.|:.|:||.||:.|..|..||:|| |||.|
Zfish   128 LKKCIEQLGRIQTELQDSVKDLAKSKKKYFELEQMAQAVREKA-DIESK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwkNP_001286994.1 BAR 16..281 CDD:353336 66/164 (40%)
SH3_FCHSD_1 545..600 CDD:212695
SH3 663..718 CDD:354299
PRK12323 <725..956 CDD:237057
LOC100537850XP_003200461.2 BAR 16..>175 CDD:299863 65/162 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D154524at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.