Sequence 1: | NP_001286994.1 | Gene: | nwk / 39052 | FlyBaseID: | FBgn0263456 | Length: | 1075 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009296641.2 | Gene: | LOC100536453 / 100536453 | -ID: | - | Length: | 194 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 75/200 - (37%) |
---|---|---|---|
Similarity: | 122/200 - (61%) | Gaps: | 7/200 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQPPPRKGNYVKFLKNLHTEQVAKLQLKNQHECDLLEDIRQFTIKRSAVEKSYSESLLKISSQYL 65
Fly 66 NKKIPNIPDIKMEGMEERWNMWSVWRTVLEENEKLARARLAAIEVFQQQIADEAKVLRDYKLAIA 130
Fly 131 KRSLAGIVNVQKELHLSVGDVDKTKKSYFDEEHCAHDVRDKARDIEEKLKKKKGSFFQSITSLQK 195
Fly 196 NSARV 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nwk | NP_001286994.1 | BAR | 16..281 | CDD:353336 | 66/184 (36%) |
SH3_FCHSD_1 | 545..600 | CDD:212695 | |||
SH3 | 663..718 | CDD:354299 | |||
PRK12323 | <725..956 | CDD:237057 | |||
LOC100536453 | XP_009296641.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H8887 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D154524at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |