DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Use1 and USE1

DIOPT Version :9

Sequence 1:NP_648289.2 Gene:Use1 / 39051 FlyBaseID:FBgn0035965 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_060937.2 Gene:USE1 / 55850 HGNCID:30882 Length:259 Species:Homo sapiens


Alignment Length:263 Identity:82/263 - (31%)
Similarity:135/263 - (51%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATKLNVNIRTLLANCEELA--KSEQNFWRLQKFIKSLDTMLAELEAMGDPQSVKRIPGYLER--- 61
            |::|.:|:..||:.||.:|  |.:.:.|||:|::.:|:.||..|:......:.:.|..|..:   
Human     3 ASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDF 67

  Fly    62 ----LQALKISTGYADVPGSTTKTPSQSSAVSETGENALKEIRQLQNSKYHNELRKELLQDSDA- 121
                |||.|:::.......:....|.:....:.....|.|.:.....::|.:|:|.|||....| 
Human    68 LKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAE 132

  Fly   122 ----LRRRRGADESSSSSGSANVQETS-GENMNQAAKYYTNAQEKITEHMLSLTRNLKEQTETAN 181
                :|:|.|.      :||..|.|.. ...::...:.:.|.|||:.|.||.|.|:||..|..|.
Human   133 PEMDVRKRTGV------AGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQ 191

  Fly   182 RIIRRDTEVVSRSAGMADRNINSLGKEAEKLEQHSKKAYKCWLWLMIAFVIATFIGMVLFMKIMK 246
            .:|::|.:.:|.|..|||:|:..|..|:|:||||::|:....||.|:..|...||.|:||::||.
Human   192 SVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMP 256

  Fly   247 KKK 249
            |.|
Human   257 KLK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Use1NP_648289.2 Use1 5..245 CDD:286796 77/254 (30%)
USE1NP_060937.2 Use1 6..255 CDD:313048 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149509
Domainoid 1 1.000 121 1.000 Domainoid score I5704
eggNOG 1 0.900 - - E1_KOG2678
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10214
Inparanoid 1 1.050 125 1.000 Inparanoid score I4718
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48592
OrthoDB 1 1.010 - - D1442410at2759
OrthoFinder 1 1.000 - - FOG0005428
OrthoInspector 1 1.000 - - oto90839
orthoMCL 1 0.900 - - OOG6_104533
Panther 1 1.100 - - LDO PTHR13050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2891
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.