DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhpr and QDPR

DIOPT Version :9

Sequence 1:NP_001014579.1 Gene:Dhpr / 39050 FlyBaseID:FBgn0035964 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_000311.2 Gene:QDPR / 5860 HGNCID:9752 Length:244 Species:Homo sapiens


Alignment Length:233 Identity:138/233 - (59%)
Similarity:176/233 - (75%) Gaps:1/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGRVVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGES 67
            |.||::|||:|||||.||..|:|.|:||.|:|:.|||:|..||:|....|:.||.:.|.::||:.
Human    10 ARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKL 74

  Fly    68 LAGEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKP 131
            |..||:||::|||||||||||| |.|.||.|||||||:.||.||:.:|.:|||.||||.|.|||.
Human    75 LGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKA 139

  Fly   132 ALEGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTP 196
            ||:||||||||||||.|||||.:||..:.||:|.|:.|:::||||||||||||.||:|||.:|||
Human   140 ALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTP 204

  Fly   197 LTEVAGLFLKWTQDQERPKTGSLLQLITTNGITQLIAA 234
            |..:...|..|...:.||.:|||:|::||.|.|:|..|
Human   205 LEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhprNP_001014579.1 DHPR_SDR_c_like 3..224 CDD:187595 132/221 (60%)
adh_short 6..188 CDD:278532 114/182 (63%)
QDPRNP_000311.2 DHPR_SDR_c_like 10..232 CDD:187595 132/221 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152294
Domainoid 1 1.000 238 1.000 Domainoid score I2309
eggNOG 1 0.900 - - E2759_KOG4022
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H271
Inparanoid 1 1.050 287 1.000 Inparanoid score I2846
Isobase 1 0.950 - 0 Normalized mean entropy S2633
OMA 1 1.010 - - QHG53721
OrthoDB 1 1.010 - - D1585354at2759
OrthoFinder 1 1.000 - - FOG0006184
OrthoInspector 1 1.000 - - oto88558
orthoMCL 1 0.900 - - OOG6_103925
Panther 1 1.100 - - LDO PTHR15104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4419
SonicParanoid 1 1.000 - - X2361
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.