DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhpr and qdprb.4

DIOPT Version :9

Sequence 1:NP_001014579.1 Gene:Dhpr / 39050 FlyBaseID:FBgn0035964 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001104643.1 Gene:qdprb.4 / 563255 ZFINID:ZDB-GENE-080219-12 Length:257 Species:Danio rerio


Alignment Length:226 Identity:123/226 - (54%)
Similarity:162/226 - (71%) Gaps:1/226 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGESLA 69
            :|::||||||||:..|.:|:|.::||.|:|:..|::|:.::.|....|:.:|.:.|...|.:.|.
Zfish    24 KVIVYGGKGALGTESVRYFRAKHWWVVSVDVRVNKEANANVKVKMTESFTDQAKQVTVGVSKLLG 88

  Fly    70 GEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKPAL 133
            .||:||:.|||||.|.|||| |.|.|.|||||||:|.||.|...:|.::|:.||||.|||||.||
Zfish    89 VEKVDAIFCVAGGQAEGNAKAKSLYKYADLMWKQNVWTSTICTHLATRYLRVGGLLTLTGAKVAL 153

  Fly   134 EGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLT 198
            ..|...:.:|||||:|||||||||...||||..|:|::|||||||||.|||.||:||..:||||.
Zfish   154 GPTAESVSFGMAKASVHQLTRSLGGPNSGLPPRSVALAILPVTLDTPTNRKIMPNADVSSWTPLN 218

  Fly   199 EVAGLFLKWTQDQERPKTGSLLQLITTNGIT 229
            .|..||.|||..:.||.:|||::|:||||.|
Zfish   219 HVTQLFFKWTVGKSRPPSGSLVELVTTNGKT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhprNP_001014579.1 DHPR_SDR_c_like 3..224 CDD:187595 118/219 (54%)
adh_short 6..188 CDD:278532 99/182 (54%)
qdprb.4NP_001104643.1 DHPR_SDR_c_like 23..244 CDD:187595 118/219 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586787
Domainoid 1 1.000 231 1.000 Domainoid score I2364
eggNOG 1 0.900 - - E2759_KOG4022
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 286 1.000 Inparanoid score I2824
OMA 1 1.010 - - QHG53721
OrthoDB 1 1.010 - - D1585354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24812
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2361
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.