DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhpr and qdpr

DIOPT Version :9

Sequence 1:NP_001014579.1 Gene:Dhpr / 39050 FlyBaseID:FBgn0035964 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001011492.1 Gene:qdpr / 496990 XenbaseID:XB-GENE-968579 Length:241 Species:Xenopus tropicalis


Alignment Length:233 Identity:137/233 - (58%)
Similarity:174/233 - (74%) Gaps:1/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGRVVIYGGKGALGSACVDHFKANNYWVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGES 67
            |.||::|||:|||||.||::|::..:||.|||:|||..|..||||....|:.||.:.|.:.|.|.
 Frog     7 AQRVLVYGGRGALGSKCVEYFRSKQWWVASIDITENASASASIVVKLSDSFTEQSDQVTAAVEEL 71

  Fly    68 LAGEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKP 131
            |:|:|:||::|||||||||:|| |...|:.|.||||||.|||||:.:|.:|||.||||.|:|||.
 Frog    72 LSGQKVDAILCVAGGWAGGSAKAKSFYKSCDQMWKQSVWTSAISSHLATKHLKEGGLLTLSGAKA 136

  Fly   132 ALEGTPGMIGYGMAKAAVHQLTRSLGAEKSGLPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTP 196
            .|..||||..|||:|||:|||.:||||||||:||.|.||:|||||||||.||..|||||:..|||
 Frog   137 GLSATPGMSAYGMSKAAIHQLCQSLGAEKSGMPAKSAAVAILPVTLDTPANRASMPDADYTCWTP 201

  Fly   197 LTEVAGLFLKWTQDQERPKTGSLLQLITTNGITQLIAA 234
            |..:|..|..|...|.||::|||:::||..|.|:|:.|
 Frog   202 LDFIAETFYNWITGQNRPQSGSLIEVITEKGKTELVPA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhprNP_001014579.1 DHPR_SDR_c_like 3..224 CDD:187595 131/221 (59%)
adh_short 6..188 CDD:278532 112/182 (62%)
qdprNP_001011492.1 DHPR_SDR_c_like 7..229 CDD:187595 131/221 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2463
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H271
Inparanoid 1 1.050 279 1.000 Inparanoid score I2853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1585354at2759
OrthoFinder 1 1.000 - - FOG0006184
OrthoInspector 1 1.000 - - oto102432
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4419
SonicParanoid 1 1.000 - - X2361
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.