DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bol and HNRNPDL

DIOPT Version :9

Sequence 1:	NP_001261614.1	Gene:	bol / 39049	FlyBaseID:	FBgn0011206	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_112740.1	Gene:	HNRNPDL / 9987	HGNCID:	5037	Length:	420	Species:	Homo sapiens

Alignment Length:	93	Identity:	24/93 - (25%)
Similarity:	48/93 - (51%)	Gaps:	13/93 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 LETPLAAPKYGTLI-----PNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYG 76
            |:..|..||....:     |.::||||:|.||:|..:...|.|:|.:::.::.:| :....:|:.
Human   213 LDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFC 277

  Fly    77 FVTFETEQEAQRLQ-------ADGECVV 97
            |:|:..|:..::|.       ..|:|.:
Human   278 FITYTDEEPVKKLLESRYHQIGSGKCEI 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bol	NP_001261614.1	RRM_DAZL_BOULE	31..111	CDD:240858	20/80 (25%)
HNRNPDL	NP_112740.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..83
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	96..120
		RRM1_hnRPDL	149..224	CDD:410152	4/10 (40%)
		RRM2_hnRPDL	234..308	CDD:409998	19/72 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	313..348
		Necessary for interaction with TNPO1. /evidence=ECO:0000269\|PubMed:9524220	342..420
		Necessary for its nuclear import and export	396..420
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	398..420
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910