DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT1G78260

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_565175.1 Gene:AT1G78260 / 844161 AraportID:AT1G78260 Length:287 Species:Arabidopsis thaliana


Alignment Length:244 Identity:61/244 - (25%)
Similarity:91/244 - (37%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQ 90
            :|.....::||||::.:|...::.|.|..:|.:....||.|: .|.|||||||||.....|.|..
plant    11 FGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV 75

  Fly    91 ADGECVV-LRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVTD 154
            ||...|: .|....|||...:.:|:|.:....|.....|.:..|:..:.:      ||..||   
plant    76 ADPNPVIDGRKANCNIASFGRPRPSPPRGRGQTGSPSQYQSGGPSTYTGM------AAPLPP--- 131

  Fly   155 FTAAGVPAIYPPSAMQYQP------------------FYQ------------------------- 176
              ||....:||.....|.|                  :||                         
plant   132 --AAAPQLMYPSYGYTYNPDQFGYHQALYNTQLQQAQYYQQQQQLYGGGATSPSSSGATIMPSPY 194

  Fly   177 YYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQ--SPCWSI 223
            ||...:..|.:   .||.:|    |.|  .|::|....|.:  ||.:.:
plant   195 YYGYSLQAPRV---PYQHHH----HLP--QPYNPQQHHHQRFSSPSFLV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 30/81 (37%)
AT1G78260NP_565175.1 RRM_RBM24_RBM38_like 17..92 CDD:409818 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.