DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT1G76460

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_565132.2 Gene:AT1G76460 / 843979 AraportID:AT1G76460 Length:285 Species:Arabidopsis thaliana


Alignment Length:79 Identity:18/79 - (22%)
Similarity:30/79 - (37%) Gaps:13/79 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AASLKDPPSNSIARPCKKPSVSEDFWSTSTVDMDNITFPSQGSLSSSNQTFDSQSAARNSNA--- 76
            |:.|.|.|..  |..|...|......:.||...:...||.:.....:::...| :|..::|:   
plant   462 ASVLTDGPKR--ANVCHSTSTKAKISAGSTESTEVRKFPLRKHCEDASRVLPS-NAENSTNSLPV 523

  Fly    77 -------PPEYVNQ 83
                   ||:.|.|
plant   524 VKPINELPPKDVKQ 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 12/63 (19%)
PABP-1234 <45..219 CDD:130689 9/49 (18%)
AT1G76460NP_565132.2 RRM_RBM24_RBM38_like 24..99 CDD:409818
PABP-1234 <37..245 CDD:130689
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.