| Sequence 1: | NP_001261614.1 | Gene: | bol / 39049 | FlyBaseID: | FBgn0011206 | Length: | 233 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_565132.2 | Gene: | AT1G76460 / 843979 | AraportID: | AT1G76460 | Length: | 285 | Species: | Arabidopsis thaliana |
| Alignment Length: | 79 | Identity: | 18/79 - (22%) |
|---|---|---|---|
| Similarity: | 30/79 - (37%) | Gaps: | 13/79 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 AASLKDPPSNSIARPCKKPSVSEDFWSTSTVDMDNITFPSQGSLSSSNQTFDSQSAARNSNA--- 76
Fly 77 -------PPEYVNQ 83 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| bol | NP_001261614.1 | RRM_DAZL_BOULE | 31..111 | CDD:409846 | 12/63 (19%) |
| PABP-1234 | <45..219 | CDD:130689 | 9/49 (18%) | ||
| AT1G76460 | NP_565132.2 | RRM_RBM24_RBM38_like | 24..99 | CDD:409818 | |
| PABP-1234 | <37..245 | CDD:130689 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||