DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and GR-RBP5

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_177563.1 Gene:GR-RBP5 / 843763 AraportID:AT1G74230 Length:289 Species:Arabidopsis thaliana


Alignment Length:76 Identity:36/76 - (47%)
Similarity:47/76 - (61%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTF-ETEQEAQRLQADGEC 95
            ::|||||||..|.|..|...||.||.|...|||||| .|.|:|:.|||| .||:.:..:|.||:.
plant    34 SKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQD 98

  Fly    96 VVLRDRKLNIA 106
            :..|..::|.|
plant    99 LHGRRIRVNYA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 36/76 (47%)
PABP-1234 <45..219 CDD:130689 28/64 (44%)
GR-RBP5NP_177563.1 RRM 33..111 CDD:440488 36/76 (47%)

Return to query results.
Submit another query.