DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBP1

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001320402.1 Gene:RBP1 / 842216 AraportID:AT1G58470 Length:360 Species:Arabidopsis thaliana


Alignment Length:205 Identity:56/205 - (27%)
Similarity:90/205 - (43%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVS---KGYGFVTFETEQEAQRLQADGEC 95
            :|||||:|.:|||.:....|..:|  ::|.::|...||:   :|:||||:::|...       |.
plant   121 KIFVGGLSSNTTEEEFKSYFERFG--RTTDVVVMHDGVTNRPRGFGFVTYDSEDSV-------EV 176

  Fly    96 VV------LRDRKLNIAPAIKKQPNPLQSIVATNG-AVYYTTTPPAPISNIPMDQFAAAVYPPVT 153
            |:      |.|:::.:..||     |.:.|.:.|| ||           |||....:....|.|.
plant   177 VMQSNFHELSDKRVEVKRAI-----PKEGIQSNNGNAV-----------NIPPSYSSFQATPYVP 225

  Fly   154 DFTAAGVPAIYPP---------SAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHS 209
            :....|:...:||         .|:||...||:.:...||.  |       ::|:: .||....:
plant   226 EQNGYGMVLQFPPPVFGYHHNVQAVQYPYGYQFTAQVANVS--W-------NNPIM-QPTGFYCA 280

  Fly   210 PHSQSHPQSP 219
            |   .||..|
plant   281 P---PHPTPP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 27/85 (32%)
RBP1NP_001320402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11176
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.