DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT1G33470

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_174613.2 Gene:AT1G33470 / 840240 AraportID:AT1G33470 Length:245 Species:Arabidopsis thaliana


Alignment Length:239 Identity:59/239 - (24%)
Similarity:86/239 - (35%) Gaps:72/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGECVV 97
            ::||||::.:|.:..|...|..:|.:....:|.|: :|.|||||||||...:.||:...| ...|
plant     8 KVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVD-PAPV 71

  Fly    98 LRDRKLNIAPAI-----KKQPNPLQSIVATNGAVYYTTTP--------------PAPIS------ 137
            :..|:.|...|.     .|..:|:...|...|  ...|:|              |.|.|      
plant    72 IDGRRANCNLAAFGVQRSKPSSPIHGHVGGRG--MKVTSPFKTHFGTAATAIPSPLPFSHYTLPY 134

  Fly   138 -------------NIPMDQF------AAAVYP-----PVTDFTAAGVPAIYPPSAMQYQ----PF 174
                         |.|...:      |.|.:|     |:|...||.....||  .:|:.    |.
plant   135 TNPFGFSSYSMDYNYPTQSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYP--YLQFAEGNGPV 197

  Fly   175 YQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQS 218
            ..|  .|::.|         ||  :.|......:.||....|.|
plant   198 TGY--APLHYP---------NH--MFHYSAPGGNYPHHNGSPVS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 27/82 (33%)
AT1G33470NP_174613.2 RRM_RBM24_RBM38_like 7..82 CDD:240830 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.