DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT1G22330

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_564168.2 Gene:AT1G22330 / 838839 AraportID:AT1G22330 Length:291 Species:Arabidopsis thaliana


Alignment Length:286 Identity:69/286 - (24%)
Similarity:98/286 - (34%) Gaps:95/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETEQEAQRLQ 90
            :|.....::||||::.:|...::.|.|..:|.:....||.|:| |.|||||||||.....|.|..
plant    11 FGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAV 75

  Fly    91 ADGECVVLRDRKLNIAPAIKKQPNP----------LQSIVATNGAVYYTTTPPAPISNIPMDQFA 145
            ||.. .|:..||.|...|...:|.|          ..|.....|...||...      .|:.|.|
plant    76 ADPN-PVIDGRKANCNIASFGRPRPSTPRGRGQGGSPSQYQGGGQSSYTGMA------APVQQAA 133

  Fly   146 AA--VYPP-----------------------------------VTDFTAAGV-PAIY-------P 165
            ||  :||.                                   .|..:::.: |:.|       |
plant   134 AAQLMYPSYGYTYNSEYGYHQALYNAQLQQAQYYQQQMYGGGGATSPSSSNIMPSPYYYLQAPSP 198

  Fly   166 PSAMQYQPFYQYYS--------------------VPMNVPTIWPQNYQENHSPLLHSPTSNPHSP 210
            ...:.:|..|||:.                    .|.||....|.|...:..||  |.::..|:|
plant   199 RPYLHHQQHYQYHHHQQQQQQQQQRLPSASSYLIYPSNVEAPTPSNVPTSQGPL--SSSTESHAP 261

  Fly   211 HSQSH----------PQSPCWSIEDL 226
            ...|.          |:|...:|.||
plant   262 QQVSEEGGEFDPTDAPESTTTNIRDL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 31/80 (39%)
AT1G22330NP_564168.2 RRM <17..198 CDD:223796 47/187 (25%)
RRM_RBM24_RBM38_like 17..92 CDD:409818 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.