DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and GR-RBP6

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_173298.1 Gene:GR-RBP6 / 838444 AraportID:AT1G18630 Length:155 Species:Arabidopsis thaliana


Alignment Length:88 Identity:28/88 - (31%)
Similarity:48/88 - (54%) Gaps:15/88 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFET-------EQE 85
            :|.|::|||||:|..|....|...|.::|.:....:::|| :|:|:|:||||:::       .|.
plant    32 SLTPSKIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA 96

  Fly    86 AQRLQADGECVVLRDRKLNIAPA 108
            .|..:.||       |.:.:.||
plant    97 MQNKELDG-------RIIGVHPA 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 27/86 (31%)
PABP-1234 <45..219 CDD:130689 19/72 (26%)
GR-RBP6NP_173298.1 RRM 37..109 CDD:214636 24/78 (31%)

Return to query results.
Submit another query.