DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBP45B

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_172630.1 Gene:RBP45B / 837708 AraportID:AT1G11650 Length:405 Species:Arabidopsis thaliana


Alignment Length:91 Identity:34/91 - (37%)
Similarity:46/91 - (50%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APKYGTLIPNRIFVGGISGDTTEADLTRVFSA-YGTVKSTKIIVDR-AGVSKGYGFVTFETEQEA 86
            :|.|      .||||.::.|.|:..|...|.| |.:||..|:::|| .|.:||||||.|..|.|.
plant   152 SPDY------TIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQ 210

  Fly    87 QRLQADGECVVLRDRKLNIAPAIKKQ 112
            .|...:...|....|.:.|.||..|:
plant   211 IRAMTEMNGVPCSTRPMRIGPAASKK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 31/81 (38%)
PABP-1234 <45..219 CDD:130689 27/70 (39%)
RBP45BNP_172630.1 RRM1_SECp43_like 63..142 CDD:409780
RRM2_SECp43_like 154..233 CDD:409781 31/84 (37%)
RRM_SF 260..331 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.