DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBM4B

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:54 Identity:17/54 - (31%)
Similarity:27/54 - (50%) Gaps:7/54 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQ 87
            ::|:|.:..:.||.::..:|..||.|....||       |.||||..|.:..|:
Human     3 KLFIGNLPREATEQEIRSLFEQYGKVLECDII-------KNYGFVHIEDKTAAE 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 17/54 (31%)
PABP-1234 <45..219 CDD:130689 15/43 (35%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018 17/54 (31%)
RRM2_RBM4 78..144 CDD:410019
PTZ00368 <145..>181 CDD:173561
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000250 196..359
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.