DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBP45A

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:175 Identity:53/175 - (30%)
Similarity:73/175 - (41%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HKIA--------AAPPPS---------ATPGGGLETPLAAPKYGTLIPNR-IFVGGISGDTTEAD 48
            |.:|        .||.||         |..|.|      ..::.|..|:. ||||.::.:.|:..
plant   111 HSVAERVLQTYNGAPMPSTEQTFRLNWAQAGAG------EKRFQTEGPDHTIFVGDLAPEVTDYM 169

  Fly    49 LTRVF-SAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK 111
            |:..| :.||:||..|:::|| .|.|||||||.|..|.|..|...:........|.:.|.||..|
plant   170 LSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRIGPAANK 234

  Fly   112 QPNPLQSIVATNGAVYYTTTPPAPISNIPMDQ--FAAAVYPPVTD 154
            ...|:|.      |:|..|.......|.|.:.  |...:...|||
plant   235 NALPMQP------AMYQNTQGANAGDNDPNNTTIFVGGLDANVTD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 31/82 (38%)
PABP-1234 <45..219 CDD:130689 38/114 (33%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780 6/26 (23%)
RRM2_SECp43_like 153..232 CDD:409781 29/78 (37%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 4/15 (27%)

Return to query results.
Submit another query.