DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT5G40490

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:124 Identity:37/124 - (29%)
Similarity:58/124 - (46%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGGLETPLAAPKYGTLIPN-----RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSK 73
            |..:|.....|: |::..|     :||||||.....:.:....|..:|.:|..:|:.|.: |.|:
plant   108 GKQVEIKRTIPR-GSMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSR 171

  Fly    74 GYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTP 132
            |:||||:|:|.....|.|.|..:.|...::.|..|..|:||.:             |||
plant   172 GFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPKKPNSV-------------TTP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 27/85 (32%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:302621 2/5 (40%)
RRM_SF 131..206 CDD:302621 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.