DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT5G09880

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_568220.1 Gene:AT5G09880 / 830848 AraportID:AT5G09880 Length:527 Species:Arabidopsis thaliana


Alignment Length:74 Identity:20/74 - (27%)
Similarity:40/74 - (54%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVV 97
            :::||.:..:.:|..|.::|.|:|.|:..::.:| ..|..||:||:.|...:.::..|      :
plant   266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQ------I 324

  Fly    98 LRDRKLNIA 106
            ..:.||.||
plant   325 ALNGKLEIA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 20/74 (27%)
PABP-1234 <45..219 CDD:130689 18/63 (29%)
AT5G09880NP_568220.1 SF-CC1 85..517 CDD:273721 20/74 (27%)

Return to query results.
Submit another query.