DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT5G06210

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:106 Identity:35/106 - (33%)
Similarity:53/106 - (50%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGE 94
            :.:::|:||:|..|||..|:..||..|.|...:|::|| :..|||:|||||.:..|||:...:..
plant    32 VASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFN 96

  Fly    95 CVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAP 135
            ...|..|.:.:..|..||.      :...|.......||.|
plant    97 GQQLNGRTIFVDYAKAKQS------LGGGGGYPIARGPPDP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 29/80 (36%)
PABP-1234 <45..219 CDD:130689 30/92 (33%)
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:473069 29/78 (37%)

Return to query results.
Submit another query.