DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AtRZ-1c

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_196048.1 Gene:AtRZ-1c / 830307 AraportID:AT5G04280 Length:310 Species:Arabidopsis thaliana


Alignment Length:58 Identity:26/58 - (44%)
Similarity:39/58 - (67%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTF 80
            |.|.|    :||||||:|.:.|:.||.|.||.:|.:...:|:::| .|.|:|:||:||
plant     2 AAKEG----SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITF 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 23/51 (45%)
PABP-1234 <45..219 CDD:130689 16/37 (43%)
AtRZ-1cNP_196048.1 RRM 8..89 CDD:440488 23/48 (48%)
zf-CCHC 128..143 CDD:395050
U2AF_lg 170..>256 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.