DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and ARP1

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_191037.1 Gene:ARP1 / 824642 AraportID:AT3G54770 Length:261 Species:Arabidopsis thaliana


Alignment Length:246 Identity:62/246 - (25%)
Similarity:91/246 - (36%) Gaps:69/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQ 90
            :|.....::||||::.||.:..:...|..||.:....||.|: ...|||||||||:..:.|.|..
plant    11 FGDTKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRAC 75

  Fly    91 ADGECVVLRDRKLN-----IAPAIKKQP---NPLQSIVATNGAV----------YYTTTPPAPIS 137
            .| ...::..|:.|     :...::|.|   :|.|.....|.|.          ||    |:..:
plant    76 ED-STPIINGRRANCNLASLGGRLRKSPTMTSPQQGPKNGNRATPPHVGNHSQWYY----PSGFT 135

  Fly   138 N----------IPMDQFAAAVYPPVTDFTAA----------GVPAIYPPSAMQYQPFYQYY---- 178
            |          :|...:.:|...|...|...          |..|...|.. |.||..|||    
plant   136 NQQHQQQNHQAVPFYGYPSAYVAPNMTFNQKVGYVGGTYMNGYYAQMQPQP-QSQPQPQYYHHHM 199

  Fly   179 ----------SVPMNVP--TIWPQNYQENHS-----PLLHSPTSNPHSPHS 212
                      :.|| ||  |::|  |.::.:     |....|.|....|.|
plant   200 YGGGRVMVGAASPM-VPFYTVYP--YHQSQAIGFPQPSFSKPLSFSTPPIS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 26/85 (31%)
ARP1NP_191037.1 RRM <17..>121 CDD:223796 32/104 (31%)
RRM_RBM24_RBM38_like 17..92 CDD:240830 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.