DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBP47B

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:159 Identity:45/159 - (28%)
Similarity:69/159 - (43%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFVGGISGDTTEADLTRVFS-AYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVV 97
            :|||.:|.|.|:..|...|| .|.:|||.|:::| ..|.|||||||.|..|.|..|...:.....
plant   204 VFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAY 268

  Fly    98 LRDRKLNIAPAIKK------QPNPLQSIV-----ATNGAVYYTTTPPAPISNIPMDQFAAAVYPP 151
            ..:|::.:..|..|      |.:..|:::     .:||::.|.:......:|..:  |...:.|.
plant   269 CSNRQMRVGIATPKRAIANQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNATI--FVGGIDPD 331

  Fly   152 VTDFTAAGVPAIYPPSAMQYQPFYQYYSV 180
            |.|....             |||.|:..|
plant   332 VIDEDLR-------------QPFSQFGEV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 29/77 (38%)
PABP-1234 <45..219 CDD:130689 40/149 (27%)
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780
RRM2_SECp43_like 201..280 CDD:409781 28/75 (37%)
RRM_SF 320..391 CDD:473069 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.