DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT2G46780

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001324122.1 Gene:AT2G46780 / 819291 AraportID:AT2G46780 Length:336 Species:Arabidopsis thaliana


Alignment Length:250 Identity:59/250 - (23%)
Similarity:90/250 - (36%) Gaps:76/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRL------QA 91
            :|||||::.:|....:.|.|..:|.:....:|.|: .|.|||||||||:..:.|.|.      ..
plant    23 KIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMNPVI 87

  Fly    92 DGECVVLRDRKLNIAPAIKKQPNPLQS----------------IVA----------TNGAVY--- 127
            ||     |....|:|....::|.|..|                :||          ::..|:   
plant    88 DG-----RRANCNLACLGAQKPRPPTSPRHGTGRFRSPGSGVGLVAPSPQFRGSSSSSAFVHQQQ 147

  Fly   128 --YTTTPPAPISN-----------IPMDQFAAAVY-----PPVTDFTAAGVPAIYPPSAMQYQPF 174
              :|...|.|.|.           .||:.:...:|     .|.....:||...::    ..:.|:
plant   148 QQHTAQFPFPYSTYGFSGYSQEGMYPMNYYNHHLYGGQQFSPYMGHPSAGSTGMF----HGFYPY 208

  Fly   175 YQYYSVPMNVPTIWPQNYQENHS------------PLLHSPTSNPHSPHSQSHPQ 217
            |..|:...:......|...::|.            |||..|.. ||.||..|..|
plant   209 YPQYNAAQSSNQAQAQVQAQHHQGFSFQYTAPPAPPLLQYPYL-PHQPHFSSQQQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 28/83 (34%)
AT2G46780NP_001324122.1 RRM_RBM24_RBM38_like 22..97 CDD:409818 27/78 (35%)
PABP-1234 <38..252 CDD:130689 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.