DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and AT2G14160

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_179031.2 Gene:AT2G14160 / 815902 AraportID:AT2G14160 Length:85 Species:Arabidopsis thaliana


Alignment Length:67 Identity:20/67 - (29%)
Similarity:29/67 - (43%) Gaps:18/67 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR------------------AGVSKGYGFVTFET 82
            :||.:..||.|.||...||.:|.|..:.:|.:|                  ....|.||||:|:.
plant    11 YVGNLESDTEENDLKNAFSQFGDVIHSNVICERDYEYFDYENGYEYDLPVSVTTRKVYGFVSFKD 75

  Fly    83 EQ 84
            |:
plant    76 EK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 20/67 (30%)
PABP-1234 <45..219 CDD:130689 16/58 (28%)
AT2G14160NP_179031.2 RRM_SF 9..>85 CDD:473069 20/67 (30%)

Return to query results.
Submit another query.