DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and PABPN1

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens


Alignment Length:108 Identity:26/108 - (24%)
Similarity:49/108 - (45%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PPPSATPG-GGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AG 70
            ||.:|.|. ..:|..:.|.      ...|:||.:....|..:|...|...|:|....|:.|: :|
Human   152 PPGNAGPVIMSIEEKMEAD------ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG 210

  Fly    71 VSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQP 113
            ..||:.::.| :::|:.|.....:..:.|.|::.:.|....:|
Human   211 HPKGFAYIEF-SDKESVRTSLALDESLFRGRQIKVIPKRTNRP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 19/80 (24%)
PABP-1234 <45..219 CDD:130689 17/70 (24%)
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147
Necessary for homooligomerization 155..306 24/105 (23%)
RRM_II_PABPN1 173..248 CDD:409966 19/75 (25%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.