DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Msi2

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006534494.1 Gene:Msi2 / 76626 MGIID:1923876 Length:378 Species:Mus musculus


Alignment Length:44 Identity:11/44 - (25%)
Similarity:17/44 - (38%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 WNQTRERWVGKDKPNNPVDHNQGAKLNWNTATYDSLLGSNKLFP 131
            |::|..|..    |.:|:    ...|.....:.|..|...:|||
Mouse     3 WDRTARRLA----PPSPL----SLLLVLVLLSRDGALHPEELFP 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 5/22 (23%)
PABP-1234 <45..219 CDD:130689 11/44 (25%)
Msi2XP_006534494.1 RRM_SF 17..104 CDD:473069 6/22 (27%)
PABP-1234 <35..363 CDD:130689 3/4 (75%)
RRM2_MSI 135..208 CDD:240769
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.