DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Rbm31y

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:90 Identity:23/90 - (25%)
Similarity:46/90 - (51%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRL------Q 90
            :::|:||:|.:.::..|....|.:|.:....|..| ..|:|:|:|||.|:.....:::      :
Mouse    33 SKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHK 97

  Fly    91 ADGECVVLRDRKLNIAPAIKKQ-PN 114
            .||:.:..:..|     |::.| ||
Mouse    98 VDGKKIEFKRAK-----ALESQFPN 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 20/84 (24%)
PABP-1234 <45..219 CDD:130689 19/78 (24%)
Rbm31yNP_083246.1 RRM_SF 34..109 CDD:473069 18/74 (24%)
RRM_SF 119..193 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.