DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Rbm31y

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:90 Identity:23/90 - (25%)
Similarity:46/90 - (51%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRL------Q 90
            :::|:||:|.:.::..|....|.:|.:....|..| ..|:|:|:|||.|:.....:::      :
Mouse    33 SKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHK 97

  Fly    91 ADGECVVLRDRKLNIAPAIKKQ-PN 114
            .||:.:..:..|     |::.| ||
Mouse    98 VDGKKIEFKRAK-----ALESQFPN 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 20/84 (24%)
Rbm31yNP_083246.1 RRM_SF 35..108 CDD:302621 18/72 (25%)
RRM_SF 119..193 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.