DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Rbm28

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_598686.2 Gene:Rbm28 / 68272 MGIID:2655711 Length:750 Species:Mus musculus


Alignment Length:81 Identity:23/81 - (28%)
Similarity:38/81 - (46%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAG-VSKGYGFVTFETEQEAQRLQADGECVVL 98
            :|||.:........|..:||..|.||...::.::.. ..:|:|:|||...::.||  |..|....
Mouse     6 LFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQR--ALKEITTF 68

  Fly    99 RDRKLNIAPAIKKQPN 114
            ...|:::..|.||..|
Mouse    69 EGCKIDVTVAKKKLRN 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 20/76 (26%)
PABP-1234 <45..219 CDD:130689 20/71 (28%)
Rbm28NP_598686.2 RRM1_RBM28_like 5..81 CDD:409847 20/76 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..110 1/1 (100%)
RRM2_RBM28_like 115..190 CDD:409848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..320
RRM3_RBM28_like 325..407 CDD:409849
RRM4_RBM28_like 477..571 CDD:409850
PTZ00108 <563..740 CDD:240271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.