DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and cirbpb

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:71 Identity:29/71 - (40%)
Similarity:41/71 - (57%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRL-------Q 90
            ::|:||:|.||||..|...||.|||:....:|.|| ...|:|:||||||..::|:..       |
Zfish     6 KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQ 70

  Fly    91 ADGECV 96
            .||..:
Zfish    71 VDGRMI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 29/71 (41%)
PABP-1234 <45..219 CDD:130689 23/60 (38%)
cirbpbNP_001035411.2 RRM_CIRBP_RBM3 5..83 CDD:409883 29/71 (41%)

Return to query results.
Submit another query.