DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Zcrb1

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_080301.1 Gene:Zcrb1 / 67197 MGIID:1914447 Length:217 Species:Mus musculus


Alignment Length:88 Identity:25/88 - (28%)
Similarity:37/88 - (42%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTLIPNR--IFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRL 89
            |.|.|::  ::|..:....|..||.|:||.||.|....|:.|: ...|||..|:.|         
Mouse     3 GGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILF--------- 58

  Fly    90 QADGECVVLRDRKLNIAPAIKKQ 112
                   :.:|..||...||..:
Mouse    59 -------LDKDSALNCTRAINNK 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 23/82 (28%)
PABP-1234 <45..219 CDD:130689 21/69 (30%)
Zcrb1NP_080301.1 RRM_ZCRB1 9..84 CDD:409827 22/82 (27%)
PTZ00368 <97..123 CDD:173561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.