DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and BOLL

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001271290.1 Gene:BOLL / 66037 HGNCID:14273 Length:339 Species:Homo sapiens


Alignment Length:270 Identity:90/270 - (33%)
Similarity:130/270 - (48%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKII 65
            |...:.:|.|:......|..|.:||:|||:||||||||||...|.|:||.:.||.||:||..||:
Human     7 MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIV 71

  Fly    66 VDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQP--NPLQSIVATNGAVYY 128
            .||||||||||||||||:::||::..:.|.:..:|:||||.|||:||.  .|..||:...|.:|.
Human    72 NDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYL 136

  Fly   129 TTT-----------------------PPAPISNI---------PMDQFAAAVYPPVTD-FTAAGV 160
            ||:                       ||.|..::         |:.|..|..|..:.. .|...:
Human   137 TTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQGIKQCHTRRWM 201

  Fly   161 PAIYP-----PSAMQYQPFYQYYSVPM----NVPTIWPQNYQENHSP---------------LLH 201
            .::.|     .:..||.|....:|||.    :.|.::.|..:..:.|               |:.
Human   202 DSLLPFTKCDEATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLME 266

  Fly   202 SPTSNPHSPH 211
            :....|:|.|
Human   267 TSVPEPYSDH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 49/79 (62%)
BOLLNP_001271290.1 RRM_BOULE 37..117 CDD:241117 49/79 (62%)
RRM <38..>119 CDD:223796 49/80 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146922
Domainoid 1 1.000 77 1.000 Domainoid score I8875
eggNOG 1 0.900 - - E33208_3BEMJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4535
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 1 1.000 - - oto89569
orthoMCL 1 0.900 - - OOG6_107966
Panther 1 1.100 - - LDO PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 1 1.000 - - X491
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.