DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and dazl

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_571599.1 Gene:dazl / 58039 ZFINID:ZDB-GENE-000405-6 Length:229 Species:Danio rerio


Alignment Length:173 Identity:53/173 - (30%)
Similarity:81/173 - (46%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQAD 92
            |.:.||.:|||||.....|.::...|:.||:||..|||..|.|:.||||||.|..:.:.|.:.  
Zfish    42 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKGYGFVYFSEDVDIQTIV-- 104

  Fly    93 GECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVTDFTA 157
            .:.:..:.:||.:.|||.|:.:. :|:                  :.||...:..|.|....:.:
Zfish   105 DQPISFKGKKLKLGPAIMKERSS-RSV------------------SSPMIGPSQWVNPTPYMYCS 150

  Fly   158 AGVPAIYPPSAM-----QYQPFYQYYSVP-MNVPTIWPQNYQE 194
            ...|.:.|||.:     ||...|.|.|.| :.||.: |.||.:
Zfish   151 CCPPGLAPPSPVFSGGNQYMQPYSYSSPPGIMVPQV-PMNYAQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 31/79 (39%)
dazlNP_571599.1 RRM <40..>132 CDD:223796 34/110 (31%)
RRM_DAZL 42..123 CDD:241116 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5283
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 1 1.000 - - oto40521
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.