Sequence 1: | NP_001261614.1 | Gene: | bol / 39049 | FlyBaseID: | FBgn0011206 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001376232.1 | Gene: | DAZ2 / 57055 | HGNCID: | 15964 | Length: | 654 | Species: | Homo sapiens |
Alignment Length: | 282 | Identity: | 76/282 - (26%) |
---|---|---|---|
Similarity: | 103/282 - (36%) | Gaps: | 94/282 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
Fly 70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPLQSIVATNGAV 126
Fly 127 YYTTTPPAP-------------------ISNIPMDQF--AAAVYPPVTDFTAAGVPAI------- 163
Fly 164 --YPPSAMQ-----------YQPFYQYYSVPMNVPTIWP---QNYQENHSPLLHSPTSNPHSPHS 212
Fly 213 ---------------QSHPQSP 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bol | NP_001261614.1 | RRM_DAZL_BOULE | 31..111 | CDD:240858 | 34/79 (43%) |
DAZ2 | NP_001376232.1 | RRM_DAZL | 35..116 | CDD:410073 | 35/82 (43%) |
PABP-1234 | <40..247 | CDD:130689 | 64/228 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165146921 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D441991at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002544 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11176 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.910 |