DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and DAZ3

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_065097.2 Gene:DAZ3 / 57054 HGNCID:15965 Length:438 Species:Homo sapiens


Alignment Length:282 Identity:76/282 - (26%)
Similarity:103/282 - (36%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
            |:....||....|...|     .|.::||.:|||||.....|.::...|..||:||..|||.:|.
Human    17 ASTQSSSAAASQGWVLP-----EGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRT 76

  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPLQSIVATNGAV 126
            |||||||||:|..:.:.|::.  |..:....:||.:.|||:|        ||.||          
Human    77 GVSKGYGFVSFVNDVDVQKIV--GSQIHFHGKKLKLGPAIRKQKLCARHVQPRPL---------- 129

  Fly   127 YYTTTPPAP-------------------ISNIPMDQF--AAAVYPPVTDFTAAGVPAI------- 163
              ...||.|                   |:..|:.|.  |.:.||........|...:       
Human   130 --VVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEY 192

  Fly   164 --YPPSAMQ-----------YQPFYQYYSVPMNVPTIWP---QNYQENHSPLLHSPTSNPHSPHS 212
              ||.||.|           ||||..|...|..|...:.   .|||        :..:.|:||..
Human   193 PTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQ--------AFPAYPNSPFQ 249

  Fly   213 ---------------QSHPQSP 219
                           .::|.||
Human   250 VATGYQFPVYNYQAFPAYPNSP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 34/79 (43%)
DAZ3NP_065097.2 RRM_DAZL 35..116 CDD:241116 35/82 (43%)
RRM <40..247 CDD:330708 64/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.