DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and hnrnpd

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:89 Identity:29/89 - (32%)
Similarity:49/89 - (55%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVV 97
            ::||||:|.|||:.||...|:.:|.|....:.:| ..|.|:|:|||.|:..:..:::      :.
Zfish    55 KMFVGGLSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGFVLFKEAESVEKV------IT 113

  Fly    98 LRDRKLN-------IAPAIK-KQP 113
            .::.|||       .|.|:| |:|
Zfish   114 QKEHKLNGKVIDPKKAKAMKTKEP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 27/85 (32%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369
RRM1_hnRNPD_like 56..129 CDD:241019 24/78 (31%)
RRM2_hnRNPD 140..214 CDD:241027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.