DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBM38

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001278709.1 Gene:RBM38 / 55544 HGNCID:15818 Length:271 Species:Homo sapiens


Alignment Length:248 Identity:72/248 - (29%)
Similarity:92/248 - (37%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PPPSATPGGGLETPLAAP-------KYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKII 65
            |.|.| |..|...|||||       |..|.  .:|||||:...||:|.|.:.|..:|.::...:|
Human     5 PAPCA-PSAGFPRPLAAPGAMHGSQKDTTF--TKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVI 66

  Fly    66 VDR-AGVSKGYGF-VTFETEQE-AQRLQADGEC------------VVLRDRKLNIAPAIKKQPNP 115
            .|| .|.|:|||| :.|..|.. :|.|..||..            |.:.||.  .|....|.|||
Human    67 TDRQTGKSRGYGFGIIFVLEGHISQALNFDGRSWNPGGIFVGEPQVTMADRA--AAERACKDPNP 129

  Fly   116 --------------------LQS-------------IVATNGAVYYTTTPPAPISNIPMDQFAAA 147
                                ||:             |..|.|...:...|||.:.  |.....||
Human   130 IIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQ--PSVVIPAA 192

  Fly   148 VYP----PVTDFTAAGVPAI--YPPSAMQYQPF---------YQYYSVPMNVP 185
            ..|    |..::|.|. ||.  |||:.....|:         :..||.|..||
Human   193 PVPSLSSPYIEYTPAS-PAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 30/94 (32%)
RBM38NP_001278709.1 RRM_RBM24_RBM38_like 34..141 CDD:409818 34/108 (31%)
PABP-1234 <46..269 CDD:130689 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.