DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and RBM23

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001339693.1 Gene:RBM23 / 55147 HGNCID:20155 Length:483 Species:Homo sapiens


Alignment Length:74 Identity:24/74 - (32%)
Similarity:37/74 - (50%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGEC 95
            |.|::||.:..:.||..|..:|..:|.:.:..::.|. .|.||||||:||          :|.||
Human   306 PMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITF----------SDSEC 360

  Fly    96 VVLRDRKLN 104
            ......:||
Human   361 ARRALEQLN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 24/74 (32%)
PABP-1234 <45..219 CDD:130689 20/61 (33%)
RBM23NP_001339693.1 SF-CC1 143..482 CDD:273721 24/74 (32%)

Return to query results.
Submit another query.