DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Hnrnpa2b1

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001361674.1 Gene:Hnrnpa2b1 / 53379 MGIID:104819 Length:353 Species:Mus musculus


Alignment Length:88 Identity:29/88 - (32%)
Similarity:41/88 - (46%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD 67
            |.|.|...|..||..:..            .::|||||..||.|..|...|..||.:.:.:||.|
Mouse    94 KRAVAREESGKPGAHVTV------------KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITD 146

  Fly    68 R-AGVSKGYGFVTFETEQEAQRL 89
            | :|..:|:|||||:......::
Mouse   147 RQSGKKRGFGFVTFDDHDPVDKI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 23/60 (38%)
PABP-1234 <45..219 CDD:130689 16/46 (35%)
Hnrnpa2b1NP_001361674.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 2/4 (50%)
RRM2_hnRNPA2B1 112..191 CDD:409995 23/58 (40%)
Disordered. /evidence=ECO:0000250|UniProtKB:P22626 193..353
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.