DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Rbm34

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus


Alignment Length:79 Identity:21/79 - (26%)
Similarity:39/79 - (49%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVVL 98
            :|||.:.....::.|...|...|::.:.:|:.: ..||.:|:|:|.|| ..:|..|........|
Mouse   293 VFVGNLPYKIEDSALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFE-NTDAVHLALKLNNSEL 356

  Fly    99 RDRKLNIAPAIKKQ 112
            ..|||.:..::.|:
Mouse   357 MGRKLRVMRSVNKE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 20/76 (26%)
PABP-1234 <45..219 CDD:130689 18/69 (26%)
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:409828
RRM2_RBM34 292..364 CDD:409829 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.