DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Boll

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006245003.1 Gene:Boll / 501143 RGDID:1559527 Length:340 Species:Rattus norvegicus


Alignment Length:322 Identity:104/322 - (32%)
Similarity:142/322 - (44%) Gaps:104/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGV 71
            :|.|:......|..|.:.|:|||:||||||||||...|.|.||.:.||.||:||..||:.|||||
  Rat    19 SPSPNPVSPVPLNNPTSGPRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGV 83

  Fly    72 SKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQP--NPLQSIVATNGAVYYTTT--- 131
            ||||||:||||:::||::..:.|.:..:|:||||.|||:||.  .|..||:...|.:|.||:   
  Rat    84 SKGYGFITFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGY 148

  Fly   132 -------------------PPA----PISNIPMDQFAAAVYPP-------------------VTD 154
                               ||:    .||:.|: ..|..||..                   |..
  Rat   149 PYTYHNGVAYFHTPEVTSVPPSWPSRSISSSPV-MVAQPVYQQPAYHYQAPAQCIPGQWQWGVPQ 212

  Fly   155 FTAAGVPAIY-PPSAMQYQP---------------------------------FYQYY---SVPM 182
            ..|:..|.:| .||.:.|||                                 ::|.|   ::.|
  Rat   213 SPASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMEASVPEPYSDHGVQAAYHQVYASSAIAM 277

  Fly   183 NVPTIWPQNYQENHSPLLHS-------PTS---NP---HSPHSQSHPQSPCWSIEDLRDTLP 231
            ..|.:.|:..:|   |.|||       |:|   .|   .|||  .||:.. :..||...|.|
  Rat   278 PAPMMQPEPIKE---PRLHSVRRSFSQPSSVGLKPRYSRSPH--FHPRKD-FRAEDSVSTPP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 48/79 (61%)
BollXP_006245003.1 RRM_BOULE 43..123 CDD:410074 48/79 (61%)
PABP-1234 <45..293 CDD:130689 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340586
Domainoid 1 1.000 76 1.000 Domainoid score I8739
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4474
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 1 1.000 - - oto96688
orthoMCL 1 0.900 - - OOG6_107966
Panther 1 1.100 - - LDO PTHR11176
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X491
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.