DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and LOC4576768

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_001237856.3 Gene:LOC4576768 / 4576768 VectorBaseID:AGAMI1_002317 Length:361 Species:Anopheles gambiae


Alignment Length:84 Identity:28/84 - (33%)
Similarity:48/84 - (57%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVV 97
            ::||||:|.:|||.||...|..||.::|..:..| ..|.|:|:.|:.::......::.|.|| .|
Mosquito    69 KLFVGGLSWETTEKDLREHFGQYGEIESINVKTDPNTGRSRGFAFIVYKASDSIDKVVAAGE-HV 132

  Fly    98 LRDRKLNIAPAIKKQPNPL 116
            |.::|::...| |.:|..:
Mosquito   133 LNNKKVDPKRA-KARPGKI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 26/77 (34%)
PABP-1234 <45..219 CDD:130689 22/73 (30%)
LOC4576768XP_001237856.3 None

Return to query results.
Submit another query.