DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and trv

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:143 Identity:41/143 - (28%)
Similarity:67/143 - (46%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HKIAAAPPPSA-TPGGGLETPLAAPKYGTLIP----NRIFVGGISGDTTEADLTRVFSAYGTVKS 61
            |.:...||.:| |.|||.:...:..:...:.|    ..||||.:|.:.....|...|:.:|.:..
  Fly   276 HSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISD 340

  Fly    62 TKIIVDRAGV-SKGYGFVTF--ETEQEAQRLQADGECVVLRDRKLNIA----PAIKKQPNPLQSI 119
            .:::.|...: |||||||:|  ::|.|:.....:|:.:..|..:.|.|    ||.|:...||   
  Fly   341 CRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPL--- 402

  Fly   120 VATNGAVYYTTTP 132
              |...||..::|
  Fly   403 --TFDEVYNQSSP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 26/90 (29%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 21/73 (29%)
RRM3_TIA1_like 416..491 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.