DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and SLIRP2

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:83 Identity:27/83 - (32%)
Similarity:40/83 - (48%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFE--------TEQEAQRL 89
            ::|||.:.......:|...||.||.|.:.:::.|| .|:||.||||.|.        :.|....|
  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75

  Fly    90 QADGECVVLRDRKLNIAP 107
              ||.  ||..::.|.:|
  Fly    76 --DGR--VLTVQRANESP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 27/83 (33%)
PABP-1234 <45..219 CDD:130689 24/72 (33%)
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 25/75 (33%)

Return to query results.
Submit another query.