DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and dazl

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_989079.1 Gene:dazl / 394676 XenbaseID:XB-GENE-1006218 Length:286 Species:Xenopus tropicalis


Alignment Length:219 Identity:71/219 - (32%)
Similarity:92/219 - (42%) Gaps:49/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SATPGGGLETPLAAPKY------GTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
            |||.....|...:|...      |.:|||.:|||||.....|..:..:|..||.||..|||.||.
 Frog     2 SATEASAGEEAASATSQAFVLPEGKVIPNTVFVGGIDITMDEMAIGNLFEKYGKVKDLKIITDRT 66

  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPA 134
            |||||||||:|..|.:.|::....  :....:||.:.|||:|    :|.|..      |..|.|.
 Frog    67 GVSKGYGFVSFYDEVDVQKIVKSQ--INFHGKKLKLGPAIRK----MQRICT------YVQTSPV 119

  Fly   135 PISNIPMDQF--------------AAAVYPPVTDFTAAGVPAIYPPSAMQ------YQPFYQYYS 179
            .||  |..||              .:.:..|||.:..|......||.|:|      .||.|    
 Frog   120 VIS--PPTQFHPTWNSQNADSYIQHSPIISPVTQYVQACPYPSSPPMAIQQIPVGCQQPSY---- 178

  Fly   180 VPMNVPTIWPQNYQENHSPLLHSP 203
              ..|...||.: |.|:  :..||
 Frog   179 --FQVSPQWPTD-QRNY--MFPSP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 36/79 (46%)
dazlNP_989079.1 RRM_DAZL 25..106 CDD:241116 37/82 (45%)
PABP-1234 <30..198 CDD:130689 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10639
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5102
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 1 1.000 - - oto103390
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.