DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and tra2b

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_957491.1 Gene:tra2b / 394172 ZFINID:ZDB-GENE-040426-1094 Length:278 Species:Danio rerio


Alignment Length:197 Identity:48/197 - (24%)
Similarity:75/197 - (38%) Gaps:62/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQADGECVVLRD 100
            |.|:|..|||.||..|||.||.:....|:.| ::..|:|:..|.||..::::..:.....:.|..
Zfish   127 VFGLSLYTTERDLREVFSKYGPLSDVCIVYDQQSRRSRGFALVYFENREDSKEAKERANGMELDG 191

  Fly   101 RKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVY---PPVTDFTAAGVPA 162
            |::.:..:|.|.|              :|.||              .:|   |     |..|.|:
Zfish   192 RRIRVDYSITKGP--------------HTPTP--------------GIYMGRP-----TYGGGPS 223

  Fly   163 I------YPPSAMQYQPFYQYYSVPMNVPTIWPQNYQEN--HSPLLHSP--TSNPHSPHSQSHPQ 217
            :      |...   |:..|..|.         .::|..|  .||   ||  :..|:...|:|...
Zfish   224 VSRRRDSYDRG---YERGYDSYE---------DRDYHNNRRRSP---SPYYSRGPYRSRSRSRSY 273

  Fly   218 SP 219
            ||
Zfish   274 SP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 23/74 (31%)
tra2bNP_957491.1 RRM_TRA2B 114..202 CDD:241085 23/74 (31%)
RRM <118..>199 CDD:223796 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.