DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001098083.2 Gene:Hnrnpa2b1 / 362361 RGDID:1310403 Length:353 Species:Rattus norvegicus


Alignment Length:88 Identity:29/88 - (32%)
Similarity:41/88 - (46%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD 67
            |.|.|...|..||..:..            .::|||||..||.|..|...|..||.:.:.:||.|
  Rat    94 KRAVAREESGKPGAHVTV------------KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITD 146

  Fly    68 R-AGVSKGYGFVTFETEQEAQRL 89
            | :|..:|:|||||:......::
  Rat   147 RQSGKKRGFGFVTFDDHDPVDKI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 23/60 (38%)
Hnrnpa2b1NP_001098083.2 Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P22626, ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 2/4 (50%)
RRM2_hnRNPA2B1 112..191 CDD:409995 23/58 (40%)
Disordered. /evidence=ECO:0000269|PubMed:24098712 193..353
HnRNPA1 302..326 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250|UniProtKB:P22626 308..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.