DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and hnrnpaba

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_997752.2 Gene:hnrnpaba / 321466 ZFINID:ZDB-GENE-030131-185 Length:340 Species:Danio rerio


Alignment Length:127 Identity:38/127 - (29%)
Similarity:57/127 - (44%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQA------ 91
            ::||||:|.||::.||...||.:|.|....|.:| ..|.|:|:||:.|:......::.|      
Zfish    70 KMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKEPSGVDKVLAQKEHRL 134

  Fly    92 DGECVVLRDRKLNIAPAIKKQP---------NP------LQSIVATNGAVYYTTTPPAPISN 138
            ||..:   |.|.  |.|:||:|         ||      ::......|.:.....|..|.||
Zfish   135 DGRQI---DPKK--AMAMKKEPVKKIFVGGLNPETTEERIREYFGAFGEIETIELPMDPKSN 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 28/83 (34%)
PABP-1234 <45..219 CDD:130689 31/116 (27%)
hnrnpabaNP_997752.2 CBFNT 1..69 CDD:311868
RRM1_hnRNPAB 65..144 CDD:410151 26/78 (33%)
RRM2_hnRNPAB 149..228 CDD:409997 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.