DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:158 Identity:48/158 - (30%)
Similarity:69/158 - (43%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-R 68
            |.|.|||....|.....:.|.| ......::||||:|.||::.||...|:.:|.|....|.:| .
Human    43 ATAAPPSGNQNGAEGDQINASK-NEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPN 106

  Fly    69 AGVSKGYGFVTFE--------TEQEAQRLQADGECVVLRDRKLNIAPAIKKQP---------NPL 116
            .|.|:|:||:.|:        .:|:..||  ||.  |:..:|   |.|:||.|         || 
Human   107 TGRSRGFGFILFKDAASVEKVLDQKEHRL--DGR--VIDPKK---AMAMKKDPVKKIFVGGLNP- 163

  Fly   117 QSIVATNGAV--YYTTTPPAPISNIPMD 142
               .||...:  |:..........:|||
Human   164 ---EATEEKIREYFGEFGEIEAIELPMD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 29/88 (33%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 8/27 (30%)
RRM1_hnRNPAB 66..145 CDD:410151 27/85 (32%)
RRM2_hnRNPAB 150..229 CDD:409997 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.