DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and HNRNPA1

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens


Alignment Length:116 Identity:33/116 - (28%)
Similarity:50/116 - (43%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD 67
            |.|.:...|..||..|..            .:||||||..||.|..|...|..||.::..:|:.|
Human    87 KRAVSREDSQRPGAHLTV------------KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTD 139

  Fly    68 R-AGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLN-----IAPAIKKQ 112
            | :|..:|:.||||:......::      |:.:...:|     :..|:.||
Human   140 RGSGKKRGFAFVTFDDHDSVDKI------VIQKYHTVNGHNCEVRKALSKQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 25/85 (29%)
PABP-1234 <45..219 CDD:130689 19/74 (26%)
HNRNPA1NP_112420.1 Globular A domain 4..94 2/6 (33%)
RRM1_hnRNPA1 12..92 CDD:410154 2/4 (50%)
Globular B domain 95..185 31/108 (29%)
RRM2_hnRNPA3 105..184 CDD:409996 25/84 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216 2/3 (67%)
RNA-binding RGG-box 218..240
HnRNPA1 312..344 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372
Nuclear targeting sequence (M9) 320..357
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.